PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG032105.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 351aa    MW: 38455.8 Da    PI: 8.5533
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG032105.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.5e-3955114362
       zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  ++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  CCG032105.1  55 QQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 114
                  7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.7E-3456112IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-2857112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52558112IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106096IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MLGNCEKMVV ISSTTNAWPQ NQIDEKSLMA STSKLMERPS QEVLSQPQQQ QQQLQQALKC  60
PRCDSSNTKF CYYNNYSLSQ PRHFCKACKR YWTRGGTLRN VPVGGGCRKN KRVKRPASAA  120
EGASNSVPSA NPNPQTPIDH ISSTSNHTNP LFYGLSGSNP SEMNLPFPGR FNPRMDSAVS  180
GYHDPQPQLN ALALGFSSGI MSTNDANGFN PTKQIQDVVT SNSLLSSYSN LFGSSTTSTN  240
TTSPIIASLL ASSFNQQKFT NGGIKESTRA PNYFQSLTVP FEELQMNGNS QSGIDMKGVK  300
TEHDQNRLDW NVPCQNQIEQ VGLSDPSMYW NTTTSVGSWH DPATMGSSVL L
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1647380.0KT164738.1 Populus tomentosa clone Potom.011G26508 F-box family protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043409.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLB9N3H40.0B9N3H4_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.14e-42Dof family protein